missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211201

Invitrogen™ Human ADAMTS2 Control Fragment Recombinant Protein

Product Code. 30211201
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211201

Brand: Invitrogen™ RP93160

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55855 (PA5-55855. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene excises the N-propeptide of type I, type II and type V procollagens. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in two transcript variants. The short transcript encodes a protein which has no significant procollagen N-peptidase activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95450
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9509
Name Human ADAMTS2 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 2; a disintegrin and metalloproteinase with thrombospondin repeats; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 2; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; ADAMs; ADAM-TS 2; ADAMTS2; ADAM-TS2; ADAMTS-2; ADAMTS-3; hPCPNI; metalloendopeptidases; mKIAA4060; NPI; PC I-NP; PCINP; PCI-NP; PCPNI; PNPI; Procollagen I N-proteinase; procollagen I/II amino propeptide-processing enzyme; Procollagen N-endopeptidase; procollagen N-proteinase; RGD1565950
Common Name ADAMTS2
Gene Symbol Adamts2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPSNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.