missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Guanylate kinase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17671-25UL
Additional Details : Weight : 0.00970kg
Description
Guanylate kinase Polyclonal antibody specifically detects Guanylate kinase in Human samples. It is validated for ImmunofluorescenceSpecifications
| Guanylate kinase | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| EC 2.7.4.8, FLJ42686, FLJ43710, GMK, GMP kinase, guanylate kinase, guanylate kinase 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATD | |
| 25 μg | |
| Cancer, Signal Transduction | |
| 2987 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |