missing translation for 'onlineSavingsMsg'
Learn More

Guanylate kinase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17671-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331337

  • 360.68 EUR / 25µL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Guanylate kinase Polyclonal antibody specifically detects Guanylate kinase in Human samples. It is validated for Immunofluorescence
Specifications

Specifications

Guanylate kinase
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
EC 2.7.4.8, FLJ42686, FLJ43710, GMK, GMP kinase, guanylate kinase, guanylate kinase 1
This antibody was developed against Recombinant Protein corresponding to amino acids: RPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATD
25 μg
Cancer, Signal Transduction
2987
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Immunofluorescence
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers