missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR160 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09485-100UL
This item is not returnable.
View return policy
Description
GPR160 Polyclonal specifically detects GPR160 in Human samples. It is validated for Western Blot.
Specifications
| GPR160 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| G protein-coupled receptor 160, GPCR150GPCR1, G-protein coupled receptor GPCR1, hGPCR1, probable G-protein coupled receptor 160, putative G protein-coupled receptor | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR160 (NP_055188). Peptide sequence FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM | |
| 100 μg | |
| GPCR | |
| 26996 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction