missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GnRH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38172-100ul
This item is not returnable.
View return policy
Description
GnRH Polyclonal antibody specifically detects GnRH in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| GnRH | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| GNRH, GnRH-associated peptide 1, gonadotropin-releasing hormone 1 (leutinizing-releasing hormone), gonadotropin-releasing hormone 1 (luteinizing-releasing hormone), GRH, LHRH, LNRH, luliberin I, Progonadoliberin I, progonadoliberin-1, prolactin release-inhibiting factor | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GnRH (NP_001076580.1).,, Sequence:, QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI | |
| 100 μL | |
| Cell Cycle and Replication, GPCR | |
| 2796 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction