missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glut3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-89762-25ul
This item is not returnable.
View return policy
Description
Glut3 Polyclonal specifically detects Glut3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Glut3 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P11169 | |
| SLC2A3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT | |
| Affinity Purified | |
| RUO | |
| 6515 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ90380, GLUT-3, GLUT3Glucose transporter type 3, brain, solute carrier family 2 (facilitated glucose transporter), member 3, solute carrier family 2, facilitated glucose transporter member 3 | |
| Rabbit | |
| 54 kDa | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction