missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FATE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
Brand: Novus Biologicals NBP1-85402
This item is not returnable.
View return policy
Description
FATE1 Polyclonal specifically detects FATE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Tekniske data
| FATE1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Cancer/testis antigen 43, CT43BJ-HCC-2 antigen, FATEfetal and adult testis expressed transcript protein, fetal and adult testis expressed 1, fetal and adult testis-expressed transcript protein, Tumor antigen BJ-HCC-2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 89885 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FATE1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion