missing translation for 'onlineSavingsMsg'
Learn More
Learn More
F-Spondin/SPON1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69044
This item is not returnable.
View return policy
Description
F-Spondin/SPON1 Polyclonal antibody specifically detects F-Spondin/SPON1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Gene Knock-Out
Specifications
| F-Spondin/SPON1 | |
| Polyclonal | |
| Western Blot Application from YCharOS., Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockout Validated Application from YCharOS. | |
| f-spondin, KIAA0762VSGP/F-spondin, MGC10724, spondin 1, (f-spondin) extracellular matrix protein, spondin 1, extracellular matrix protein, spondin-1, Vascular smooth muscle cell growth-promoting factor, VSGP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPV | |
| 100 μg | |
| Neuroscience | |
| 10418 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Gene Knock-Out | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction