missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELOVL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33500-25ul
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
ELOVL5 Polyclonal specifically detects ELOVL5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
| ELOVL5 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q9NYP7 | |
| ELOVL5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD | |
| 25 μL | |
| Cardiovascular Biology, Cellular Signaling | |
| 60481 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering