missing translation for 'onlineSavingsMsg'
Learn More
Learn More
E2F-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 EUR - 456.00 EUR
Specifications
| Antigen | E2F-1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18214274
|
Novus Biologicals
NBP2-56716 |
100 μL |
456.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18671377
|
Novus Biologicals
NBP2-56716-25ul |
25 μL |
302.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
E2F-1 Polyclonal specifically detects E2F-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifikationer
| E2F-1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Cycle and Replication, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1869 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| E2F transcription factor 1, E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3, transcription factor E2F1 | |
| E2F1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel