missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DC-SIGNR/CD299/CLEC4M Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59182
This item is not returnable.
View return policy
Description
DC-SIGNR/CD299/CLEC4M Polyclonal specifically detects DC-SIGNR/CD299/CLEC4M in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| DC-SIGNR/CD299/CLEC4M | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CD209L1, CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2, CD299, CD299 antigenMGC129964, C-type lectin domain family 4, member M, DC-SIGN2CD209 antigen-like protein 1, DC-SIGNRDC-SIGN-related protein, DCSIGNRMGC47866, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, HP10347, liver/lymph node-specific ICAM-3 grabbing non-integrin, Liver/lymph node-specific ICAM-3-grabbing non-integrin, L-SIGN, LSIGNC-type lectin domain family 4 member M, mannose binding C-type lectin DC-SIGNR | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q9H2X3 | |
| CLEC4M | |
| Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the N terminal of CLEC4M. Peptide sequence LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV. | |
| 100 μL | |
| Signal Transduction | |
| 10332 | |
| Human, Pig | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction