missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COUP-TF II/NR2F2 Antibody (1D8), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00007026-M02
This item is not returnable.
View return policy
Description
COUP-TF II/NR2F2 Monoclonal antibody specifically detects COUP-TF II/NR2F2 in Human samples. It is validated for ELISA, ELISA
Specifications
| COUP-TF II/NR2F2 | |
| Monoclonal | |
| Unconjugated | |
| NP_066285 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 7026 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2b κ |
| ELISA, Sandwich ELISA | |
| 1D8 | |
| In 1x PBS, pH 7.4 | |
| Apolipoprotein A-I regulatory protein 1, ARP-1, ARP1ADP-ribosylation factor related protein 1, chicken ovalbumin upstream promoter transcription factor 2, COUP transcription factor 2, COUP transcription factor II, COUP-TF II, COUP-TF2, COUPTFB, COUPTFII, COUP-TFII, MGC117452, Nuclear receptor subfamily 2 group F member 2, nuclear receptor subfamily 2, group F, member 2, SVP40, TFCOUP2apolipoprotein AI regulatory protein 1 | |
| NR2F2 (NP_066285, 153 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction