missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Clusterin-like 1/CLUL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 EUR
Specifications
| Antigen | Clusterin-like 1/CLUL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Clusterin-like 1/CLUL1 Polyclonal specifically detects Clusterin-like 1/CLUL1 in Human samples. It is validated for Western Blot.Specifications
| Clusterin-like 1/CLUL1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Vision | |
| clusterin-like 1 (retinal), clusterin-like protein 1, RA337M, Retinal-specific clusterin-like protein | |
| CLUL1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q15846 | |
| 27098 | |
| Synthetic peptides corresponding to CLUL1 (clusterin-like 1 (retinal)) The peptide sequence was selected from the middle region of CLUL1)(50ug). Peptide sequence TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title