missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CFAP97 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 EUR - 624.00 EUR
Specifications
| Antigen | KIAA1430 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18110368
|
Novus Biologicals
NBP2-47408 |
0.1 mL |
624.00 EUR
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639595
|
Novus Biologicals
NBP2-47408-25ul |
25 μL |
415.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
CFAP97 Polyclonal specifically detects CFAP97 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| KIAA1430 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| KIAA1430 | |
| KIAA1430 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 57587 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGEVDHSFFDSDFEEGKKCETNSVFDKQNDDPKERIDKDTKNVNSNTGMQTTENYLTEKGNERNVKFPPEHPVENDVTQTVSSFSLP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts