missing translation for 'onlineSavingsMsg'
Learn More

CEACAM20 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-09600-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331426

  • 449.23 EUR / 100µL
Estimated Shipment: 15-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

CEACAM20 Polyclonal specifically detects CEACAM20 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CEACAM20
Polyclonal
Western Blot 1.0 ug/ml
Rabbit
Affinity purified
RUO
125931
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS buffer, 2% sucrose
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEACAM20. Peptide sequence VIAVASELGYFLCIRNARRPSRKTTEDPSHETSQPIPKEEHPTEPSSESL
100 μg
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers