missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK8 Antibody (6E5), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00001024-M02
This item is not returnable.
View return policy
Description
CDK8 Monoclonal antibody specifically detects CDK8 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, ELISA
Specifications
| CDK8 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35 | |
| CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY | |
| 0.1 mg | |
| Cell Cycle and Replication | |
| 1024 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 6E5 | |
| Western Blot 1:500 | |
| NP_001251 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction