missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC28A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 EUR
Specifications
| Antigen | CCDC28A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC28A Polyclonal specifically detects CCDC28A in Human samples. It is validated for Western Blot.Specifications
| CCDC28A | |
| Polyclonal | |
| Rabbit | |
| NP_056254 | |
| 25901 | |
| Synthetic peptide directed towards the middle region of human CCDC28AThe immunogen for this antibody is CCDC28A. Peptide sequence ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf80, CCRL1APMGC131913, chemokine C-C motif receptor-like 1 adjacent, chromosome 6 open reading frame 80, coiled-coil domain containing 28A, coiled-coil domain-containing protein 28A, DKFZp586D0623 | |
| CCDC28A | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title