missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16101382

Thy-1 cell surface antigen, Mouse, Polyclonal Antibody, Abnova™

Product Code. 16101382
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16101382 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16101382 Supplier Abnova Supplier No. H00007070B01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a full-length human THY1 protein.

Sequence: MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL

Specifications

Antigen Thy-1 cell surface antigen
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human THY1 protein.
Formulation No additive
Gene THY1
Gene Accession No. BC005175
Gene Alias CD90/FLJ33325
Gene Symbols THY1
Host Species Mouse
Immunogen THY1 (AAH05175, 1 a.a. ∼ 161 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Stem Cell Biology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 7070
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.