Learn More
Sp3 transcription factor, Mouse, Clone: 2F6, Abnova™
Mouse monoclonal antibody raised against a full-length recombinant SP3.
Brand: Abnova H00006670-M08.100ug
Description
This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. [provided by RefSeq
Sequence: TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*Specifications
| Sp3 transcription factor | |
| Monoclonal | |
| Unconjugated | |
| PBS with no preservative; pH 7.4 | |
| NM_003111 | |
| SP3 | |
| SP3 (NP_003102, 287 a.a. ∼ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| 100 μg | |
| Transcription Regulation | |
| Primary | |
| Human | |
| Antibody |
| ELISA, Western Blot | |
| 2F6 | |
| Mouse monoclonal antibody raised against a full length recombinant SP3. | |
| SP3 | |
| DKFZp686O1631/SPR-2 | |
| Mouse | |
| Affinity Purified | |
| RUO | |
| Yes | |
| 6670 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| IgG2a κ |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.