missing translation for 'onlineSavingsMsg'
Learn More

regulator of G-protein signaling 5, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RGS5.

Brand: Abnova H00008490-A01

Product Code. 16178625

233.00 EUR / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM

Sequence: WIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Specifications

Antigen	regulator of G-protein signaling 5
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant RGS5.
Gene	RGS5
Gene Alias	MST092/MST106/MST129/MSTP032/MSTP092/MSTP106/MSTP129
Host Species	Mouse
Quantity	50 μL
Research Discipline	Signal Transduction
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_003617
Gene Symbols	RGS5
Immunogen	RGS5 (NM_003617, 94 a.a. ∼ 181 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	8490
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

regulator of G-protein signaling 5, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions