missing translation for 'onlineSavingsMsg'
Learn More

poliovirus receptor-related 1 (herpesvirus entry mediator C), Mouse, Polyclonal Antibody, Abnova™

Name: poliovirus receptor-related 1 (herpesvirus entry mediator C), Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16163935
Price: 226.00 EUR

Mouse polyclonal antibody raised against a partial recombinant PVRL1.

Brand: Abnova H00005818-A01.50uL

Additional Details : Weight : 0.00010kg

Product Code. 16163935

226.00 EUR / 50µL

Estimated Shipment: 18-07-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: VQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTV

Specifications

Antigen	poliovirus receptor-related 1 (herpesvirus entry mediator C)
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant PVRL1.
Gene	PVRL1
Gene Alias	CD111/CLPED1/ED4/HIgR/HVEC/MGC142031/MGC16207/OFC7/PRR/PRR1/PVRR/PVRR1/SK-12/nectin-1
Host Species	Mouse
Quantity	50 μL
Research Discipline	Cell Adhesion
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_002855
Gene Symbols	PVRL1
Immunogen	PVRL1 (NP_002846, 33 a.a. ∼ 142 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	5818
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

poliovirus receptor-related 1 (herpesvirus entry mediator C), Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Special Offers