missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANKRD65 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 EUR
Specifications
| Antigen | ANKRD65 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ANKRD65 Polyclonal specifically detects ANKRD65 in Human samples. It is validated for Western Blot.Specifications
| ANKRD65 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 441869 | |
| Synthetic peptide directed towards the C terminal of human hCG_20426. Peptide sequence LAAERGHGPTVGLLLSRGASPTLRTQWAEVAQMPEGDLPQALPELGGGEK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ankyrin repeat domain 65, hypothetical protein LOC441869 | |
| ANKRD65 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title