missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-2B Adrenergic R/ADRA2B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17799-100UL
This item is not returnable.
View return policy
Description
alpha-2B Adrenergic R/ADRA2B Polyclonal antibody specifically detects alpha-2B Adrenergic R/ADRA2B in Human samples. It is validated for Immunofluorescence
Specifications
| alpha-2B Adrenergic R/ADRA2B | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| ADRA2B adrenergic, alpha-2B-, receptor, ADRA2L1adrenergic receptor alpha 2B, ADRA2RL1, ADRARL1, adrenergic, alpha-2B-, receptor, Alpha-2 adrenergic receptor subtype C2, alpha-2-adrenergic receptor-like 1, alpha-2B adrenergic receptor, Alpha-2B adrenoceptor, Alpha-2B adrenoreceptor, alpha-2B-adrenergic receptor, Alpha-2BAR, ALPHA2BAR, G-protein coupled receptor | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF | |
| 100 μg | |
| Adaptive Immunity, GPCR, Immunology, Innate Immunity | |
| 151 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction