missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Acetyl-CoA Carboxylase alpha/ACACA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 EUR - 529.00 EUR
Specifications
| Antigen | Acetyl-CoA Carboxylase alpha/ACACA |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18252795
|
Novus Biologicals
NBP2-55439 |
100 μL |
529.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18665158
|
Novus Biologicals
NBP2-55439-25ul |
25 μL |
369.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Acetyl-CoA Carboxylase alpha/ACACA Polyclonal specifically detects Acetyl-CoA Carboxylase alpha/ACACA in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Acetyl-CoA Carboxylase alpha/ACACA | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Lipid and Metabolism, Nutrient Sensing in the Brain | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 31 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ACACacetyl-CoA carboxylase 1, ACC1ACC, ACCA, ACC-alpha, acetyl-CoA carboxylase alpha, acetyl-Coenzyme A carboxylase alpha, EC 6.4.1.2 | |
| ACACA | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title