missing translation for 'onlineSavingsMsg'
Learn More

RIPK5 Antibody (4D5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00025778-M08

Additional Details : Weight : 0.00970kg

Product Code. 18331469

  • 584.22 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

RIPK5 Monoclonal antibody specifically detects RIPK5 in Human samples. It is validated for Western Blot, ELISA
Specifications

Specifications

RIPK5
Monoclonal
Unconjugated
In 1x PBS, pH 7.4
dual serine/threonine and tyrosine protein kinase, Dusty PK, Dusty protein kinase, DUSTYPK, KIAA0472RIP-homologous kinase, receptor interacting protein 5, receptor interacting protein kinase 5, Receptor-interacting serine/threonine-protein kinase 5, RIP5EC 2.7.12.1, RIPK5, sgK496, Sugen kinase 496
DSTYK (NP_056190, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE
0.1 mg
Protein Kinase
25778
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG2b κ
Western Blot, ELISA
4D5
Western Blot 1:500
NP_056190
Mouse
IgG purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers