missing translation for 'onlineSavingsMsg'
Learn More

NDUFAB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals H00004706-D01P

Additional Details : Weight : 0.00970kg

Product Code. 18331638

  • 597.18 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

NDUFAB1 Polyclonal antibody specifically detects NDUFAB1 in Human samples. It is validated for Western Blot
Specifications

Specifications

NDUFAB1
Polyclonal
PBS (pH 7.4)
ACPMGC65095, acyl carrier protein, mitochondrial, CI-SDAP, complex I SDAP subunit, FASN2A, mitochondrial acyl carrier protein, NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP), NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa, NADH:ubiquinone oxidoreductase SDAP subunit, NADH-ubiquinone oxidoreductase 9.6 kDa subunit, SDAP
NDUFAB1 (NP_004994.1, 1 a.a. - 156 a.a.) full-length human protein. MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
0.1 mg
Core ESC Like Genes, Stem Cell Markers
4706
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG
Western Blot
Unconjugated
NP_004994.1
Rabbit
Protein A purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers