missing translation for 'onlineSavingsMsg'
Learn More

ETV5/ERM Antibody (7C10), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00002119-M02

Additional Details : Weight : 0.00970kg

Product Code. 18331278

  • 584.22 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ETV5/ERM Monoclonal antibody specifically detects ETV5/ERM in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA
Specifications

Specifications

ETV5/ERM
Monoclonal
Unconjugated
In 1x PBS, pH 7.4
ERMEts-related protein ERM, ETS translocation variant 5, ets variant 5, ets variant gene 5 (ets-related molecule), ets-related molecule
ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
0.1 mg
Cancer
2119
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG1 κ
Western Blot, ELISA
7C10
Western Blot 1:500
NP_004445
Mouse
IgG purified
RUO
Primary
Human, Mouse, Rat
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers