missing translation for 'onlineSavingsMsg'
Learn More

SIRPB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09533-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331697

  • 449.23 EUR / 100µL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

SIRPB2 Polyclonal specifically detects SIRPB2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SIRPB2
Polyclonal
Western Blot 1.0 ug/ml
dJ776F14.2, Protein Tyrosine Phosphatase Non-Receptor Type Substrate 1-Like 3, Protein Tyrosine Phosphatase Non-Receptor Type Substrate Protein, Protein Tyrosine Phosphatase, Non-Receptor Type 1-Like, Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1-Like 3, PTPN1L, PTPNS1L3, Signal-Regulatory Protein Beta 2, Signal-Regulatory Protein Beta-2, SIRP-beta-2, SIRPG
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIRPB2 (NP_001128308). Peptide sequence VSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPAT
100 μg
Primary
Human
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
284759
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers