missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SIRPB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09533-100UL
This item is not returnable.
View return policy
Description
SIRPB2 Polyclonal specifically detects SIRPB2 in Human samples. It is validated for Western Blot.
Specifications
SIRPB2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
dJ776F14.2, Protein Tyrosine Phosphatase Non-Receptor Type Substrate 1-Like 3, Protein Tyrosine Phosphatase Non-Receptor Type Substrate Protein, Protein Tyrosine Phosphatase, Non-Receptor Type 1-Like, Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1-Like 3, PTPN1L, PTPNS1L3, Signal-Regulatory Protein Beta 2, Signal-Regulatory Protein Beta-2, SIRP-beta-2, SIRPG | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIRPB2 (NP_001128308). Peptide sequence VSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPAT | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
284759 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction