missing translation for 'onlineSavingsMsg'
Learn More

SIRPB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09533-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331697

Estimated Shipment: 26-08-2024
to see stock.

Description

SIRPB2 Polyclonal specifically detects SIRPB2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SIRPB2
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	dJ776F14.2, Protein Tyrosine Phosphatase Non-Receptor Type Substrate 1-Like 3, Protein Tyrosine Phosphatase Non-Receptor Type Substrate Protein, Protein Tyrosine Phosphatase, Non-Receptor Type 1-Like, Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1-Like 3, PTPN1L, PTPNS1L3, Signal-Regulatory Protein Beta 2, Signal-Regulatory Protein Beta-2, SIRP-beta-2, SIRPG
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIRPB2 (NP_001128308). Peptide sequence VSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPAT
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	284759
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description