missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL35A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10041-25UL
Additional Details : Weight : 0.00970kg
Description
RPL35A Polyclonal specifically detects RPL35A in Human samples. It is validated for Western Blot.Specifications
| RPL35A | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Cell growth-inhibiting gene 33 protein, DBA5,60S ribosomal protein L35a, ribosomal protein L35a | |
| The immunogen is a synthetic peptide directed towards the middle region of human RPL35A (NP_000987.2). Peptide sequence LKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRA | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6165 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |