missing translation for 'onlineSavingsMsg'
Learn More

RPL35A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10041-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331575

  • 191.14 EUR / 25µL
Estimated Shipment: 15-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

RPL35A Polyclonal specifically detects RPL35A in Human samples. It is validated for Western Blot.
Specifications

Specifications

RPL35A
Polyclonal
Western Blot 1.0 ug/ml
Cell growth-inhibiting gene 33 protein, DBA5,60S ribosomal protein L35a, ribosomal protein L35a
The immunogen is a synthetic peptide directed towards the middle region of human RPL35A (NP_000987.2). Peptide sequence LKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRA
25 μg
Primary
Human
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
6165
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers