missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse IL 17 A/F Protein
A cDNA sequence encoding the IL 17 A/F was constructed and used to recombinantly synthesize the protein.
Marke: enQuireBio™ QP12392-10ug
Weitere Details : Weight : 0.01000kg
Spezifikation
IL 17 A/F Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA | |
Greater than 97.0% as determined by SDS-PAGE. |
10 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Mouse | |
Untagged | |
Lyophilized from a concentrated (1 mg/ml) solution containing no additives. |