missing translation for 'onlineSavingsMsg'
Learn More

PTPIP51 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17917-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331286

  • 360.68 EUR / 25µL
Estimated Shipment: 12-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

PTPIP51 Polyclonal antibody specifically detects PTPIP51 in Human samples. It is validated for Western Blot
Specifications

Specifications

PTPIP51
Polyclonal
Western Blot 0.04-0.4 ug/ml
Cerebral protein 10, FAM82Cmicrotubule-associated protein, family with sequence similarity 82, member A2, FLJ10579, hRMD-3, Protein FAM82A2, Protein FAM82C, Protein tyrosine phosphatase-interacting protein 51, ptpip51, PTPIP51family with sequence similarity 82, member C, regulator of microtubule dynamics 3, regulator of microtubule dynamics protein 3, RMD3, RMD-3, TCPTP-interacting protein 51
This antibody was developed against Recombinant Protein corresponding to amino acids: SQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGE
25 μg
Primary
Human
Purified
Western Blot
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
55177
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers