missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCDP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09303-100UL
Additional Details : Weight : 0.00970kg
Description
PCDP1 Polyclonal specifically detects PCDP1 in Human samples. It is validated for Western Blot.Specifications
PCDP1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
AC069154.2, primary ciliary dyskinesia protein 1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCDP1. Peptide sequence SHPKYKFTKESRHGSSIPVTQKQFLHHTDIIPGIMHWKSFQSLVLSSLPD | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
200373 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |