missing translation for 'onlineSavingsMsg'
Learn More

PCDP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09303-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331727

Estimated Shipment: 26-08-2024
to see stock.

Description

PCDP1 Polyclonal specifically detects PCDP1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	PCDP1
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	AC069154.2, primary ciliary dyskinesia protein 1
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCDP1. Peptide sequence SHPKYKFTKESRHGSSIPVTQKQFLHHTDIIPGIMHWKSFQSLVLSSLPD
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	200373
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description