missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OSAP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17084-100UL
Additional Details : Weight : 0.00970kg
Description
OSAP Polyclonal antibody specifically detects OSAP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
OSAP | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
chromosome 4 open reading frame 49, hypoxia up-regulated mitochondrial movement regulator, MGC125827, MGC125828, OSAP | |
This antibody was developed against Recombinant Protein corresponding to amino acids: ARETTEVNPETTPEVTNAALDEAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEAASAQG | |
100 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
84709 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |