missing translation for 'onlineSavingsMsg'
Learn More

OSAP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17084-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331807

Estimated Shipment: 26-08-2024
to see stock.

Description

OSAP Polyclonal antibody specifically detects OSAP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	OSAP
Classification	Polyclonal
Dilution	Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias	chromosome 4 open reading frame 49, hypoxia up-regulated mitochondrial movement regulator, MGC125827, MGC125828, OSAP
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: ARETTEVNPETTPEVTNAALDEAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEAASAQG
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	84709
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description