missing translation for 'onlineSavingsMsg'
Learn More

KIF2C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17038-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331526

  • 575.58 EUR / 100µL
Estimated Shipment: 15-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

KIF2C Polyclonal antibody specifically detects KIF2C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

KIF2C
Polyclonal
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
kinesin family member 2C, kinesin-like 6 (mitotic centromere-associated kinesin), Kinesin-like protein 6, kinesin-like protein KIF2C, MCAKKNSL6kinesin-like 6, Mitotic centromere-associated kinesin
This antibody was developed against Recombinant Protein corresponding to amino acids: MDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQK
100 μg
Cancer, Cell Biology, Cellular Markers, DNA Repair
11004
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers