missing translation for 'onlineSavingsMsg'
Learn More

KIF2C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17038-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331526

Estimated Shipment: 26-08-2024
to see stock.

Description

KIF2C Polyclonal antibody specifically detects KIF2C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	KIF2C
Classification	Polyclonal
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias	kinesin family member 2C, kinesin-like 6 (mitotic centromere-associated kinesin), Kinesin-like protein 6, kinesin-like protein KIF2C, MCAKKNSL6kinesin-like 6, Mitotic centromere-associated kinesin
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: MDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQK
Quantity	100 μg
Research Discipline	Cancer, Cell Biology, Cellular Markers, DNA Repair
Gene ID (Entrez)	11004
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Description