missing translation for 'onlineSavingsMsg'
Learn More

KCTD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17507-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331735

Estimated Shipment: 26-08-2024
to see stock.

Description

KCTD1 Polyclonal antibody specifically detects KCTD1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	KCTD1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	BTB/POZ domain-containing protein KCTD1, C18orf5, potassium channel tetramerisation domain containing 1
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	284252
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description