missing translation for 'onlineSavingsMsg'
Learn More

KCTD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17507-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331735

  • 575.58 EUR / 100µL
Estimated Shipment: 12-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

KCTD1 Polyclonal antibody specifically detects KCTD1 in Human samples. It is validated for Immunofluorescence
Specifications

Specifications

KCTD1
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
BTB/POZ domain-containing protein KCTD1, C18orf5, potassium channel tetramerisation domain containing 1
This antibody was developed against a recombinant protein corresponding to the amino acids: LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
100 μg
Primary
Human
Purified
Immunofluorescence
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
284252
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers