missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IER3IP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Bio-Techne NBP1-90884
Additional Details : Weight : 0.00970kg
Description
IER3IP1 Polyclonal specifically detects IER3IP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
IER3IP1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
immediate early response 3 interacting protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
51124 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
IER3IP1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only