missing translation for 'onlineSavingsMsg'
Learn More

IER3IP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP1-90884

Additional Details : Weight : 0.00970kg

Product Code. 18331380

  • 484.87 EUR / 0.10mL
Estimated Shipment: 12-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

IER3IP1 Polyclonal specifically detects IER3IP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

IER3IP1
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
immediate early response 3 interacting protein 1
Rabbit
Affinity Purified
RUO
51124
Human
IgG
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
IER3IP1
This antibody was developed against Recombinant Protein corresponding to amino acids:IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

For Research Use Only