missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IER3IP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Bio-Techne NBP1-90884
This item is not returnable.
View return policy
Description
IER3IP1 Polyclonal specifically detects IER3IP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| IER3IP1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| immediate early response 3 interacting protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51124 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IER3IP1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only