missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZNF444 Partial ORF (NP_060807.2, 38 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 EUR - 508.00 EUR
Specifications
Accession Number | NP_060807.2 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 55311 |
Molecular Weight (g/mol) | 36.3kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16035555
|
Abnova™
H00055311-Q01.25UG |
25 ug |
508.00 EUR
25µg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16025555
|
Abnova™
H00055311-Q01.10UG |
10 ug |
335.00 EUR
10µg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM]
Sequence: LGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMISpecifications
NP_060807.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.3kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
EZF-2/EZF2/FLJ11137/ZSCAN17 | |
ZNF444 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
55311 | |
ZNF444 (Human) Recombinant Protein (Q01) | |
LGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMI | |
RUO | |
ZNF444 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |