missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RARA Partial ORF (NP_000955, 169 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005914-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16034645

  • 335.00 EUR / 10µg
Estimated Shipment: 23-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor (RXR; see MIM 180245), which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1 (MIM 600849), SMRT (NCOR2; MIM 600848), and histone deacetylase (see MIM 601241). When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases (see MIM 603053), and the basic transcription machinery. Translocations that always involve rearrangement of the RARA gene are a cardinal feature of acute promyelocytic leukemia (APL; MIM 612376). The most frequent translocation is t(15,17)(q21;q22), which fuses the RARA gene with the PML gene (MIM 102578) (Vitoux et al., 2007 [PubMed 17468032]).[supplied by OMIM]

Sequence: VPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKC
Specifications

Specifications

NP_000955
Liquid
5914
RARA (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NR1B1/RAR
RARA
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33kDa
12.5% SDS-PAGE Stained with Coomassie Blue
VPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKC
RUO
RARA
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers