missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PIM3 Partial ORF (NP_001001852.1, 242 a.a. - 326 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00415116-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
PIM3 belongs to a family of protooncogenes that encode serine/threonine protein kinases (Mikkers et al., 2004 [PubMed 15199164]).[supplied by OMIM]
Sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESLSpecifications
NP_001001852.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.09kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL | |
RUO | |
PIM3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
415116 | |
PIM3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
pim-3 | |
PIM3 | |
Recombinant | |
wheat germ expression system |