Learn More
Abnova™ Human MEF2B Partial ORF (NP_005910.1, 165 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 EUR - 508.00 EUR
Specifications
Accession Number | NP_005910.1 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 4207 |
Molecular Weight (g/mol) | 33.44kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16044385
|
Abnova™
H00004207-Q01.25UG |
25 ug |
508.00 EUR
25µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16034385
|
Abnova™
H00004207-Q01.10UG |
10 ug |
335.00 EUR
10µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq]
Sequence: SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNPSpecifications
NP_005910.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.44kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ32599/FLJ46391/MGC189732/MGC189763/RSRFR2 | |
MEF2B | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
4207 | |
MEF2B (Human) Recombinant Protein (Q01) | |
SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP | |
RUO | |
MEF2B | |
Wheat Germ (in vitro) | |
GST | |
Liquid |