missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LZTFL1 Partial ORF (AAH25988.1, 39 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054585-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025545

  • 335.00 EUR / 10µg
Estimated Shipment: 26-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
Specifications

Specifications

AAH25988.1
Liquid
54585
LZTFL1 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ36386
LZTFL1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.65kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
RUO
LZTFL1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers