missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HES5 Partial ORF (NP_001010926.1, 28 a.a. - 121 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 EUR - 508.00 EUR
Specifications
| Accession Number | NP_001010926.1 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 388585 |
| Molecular Weight (g/mol) | 35.97kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16025835
|
Abnova™
H00388585-Q01.25UG |
25 ug |
508.00 EUR
25µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16015835
|
Abnova™
H00388585-Q01.10UG |
10 ug |
335.00 EUR
10µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq]
Sequence: RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRSpecifications
| NP_001010926.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.97kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| bHLHb38 | |
| HES5 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 388585 | |
| HES5 (Human) Recombinant Protein (Q01) | |
| RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR | |
| RUO | |
| HES5 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |