missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FKBP6 Partial ORF (NP_003593.2, 1 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 EUR - 508.00 EUR
Specifications
| Accession Number | NP_003593.2 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 8468 |
| Molecular Weight (g/mol) | 37.62kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16178605
|
Abnova™
H00008468-Q01.25UG |
25 ug |
508.00 EUR
25µg |
Estimated Shipment: 28-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16168605
|
Abnova™
H00008468-Q01.10UG |
10 ug |
335.00 EUR
10µg |
Estimated Shipment: 28-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein may have cis-trans prolyl isomerase activity, and binds to clathrin heavy chain and heat shock protein 72. This gene is found to be deleted in Williams syndrome, and the orthologous gene in mouse is essential for fertility and homologous pairing in male meiosis. [provided by RefSeq]
Sequence: MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELASpecifications
| NP_003593.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.62kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FKBP36/MGC87179/PPIase | |
| FKBP6 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8468 | |
| FKBP6 (Human) Recombinant Protein (Q01) | |
| MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELA | |
| RUO | |
| FKBP6 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |