missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CBX2 Partial ORF (NP_116036, 66 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084733-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005725

  • 302.00 EUR / 10µg


Estimated Shipment
11-02-2020
Add to basket

Description

Description

Sequence: EVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSP
Specifications

Specifications

NP_116036
Liquid
84733
CBX2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CDCA6|M33|MGC10561
CBX2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSP
RUO
CBX2
wheat germ expression system
Yes
Videos
Documents