missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CALN1 Partial ORF (NP_113656.1, 36 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00083698-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005705

  • 302.00 EUR / 10µg


Estimated Shipment
06-08-2020
Add to basket

Description

Description

Sequence: EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLV
Specifications

Specifications

AAH20200
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.55kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLV
RUO
CALN1
Yes
wheat germ expression system
Liquid
83698
CALN1 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CALN1
Wheat Germ (in vitro)
GST
Videos
Documents