missing translation for 'onlineSavingsMsg'
Learn More

GRG (Groucho homolog) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10933-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331585

Estimated Shipment: 26-08-2024
to see stock.

Description

GRG (Groucho homolog) Polyclonal specifically detects GRG (Groucho homolog) in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	GRG (Groucho homolog)
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	AES-1, AES-2, Amino enhancer of split, amino-terminal enhancer of split, ESP1, Gp130-associated protein GAM, GRG, GRG5, Protein ESP1, Protein GRG, TLE5
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse GRG (Groucho homolog) (NP_034477). Peptide sequence QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK
Quantity	100 μg
Research Discipline	Apoptosis, Signal Transduction, Wnt Signaling Pathway
Gene ID (Entrez)	166
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description