missing translation for 'onlineSavingsMsg'
Learn More

GRG (Groucho homolog) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10933-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331585

  • 449.23 EUR / 100µL
Estimated Shipment: 15-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

GRG (Groucho homolog) Polyclonal specifically detects GRG (Groucho homolog) in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

GRG (Groucho homolog)
Polyclonal
Western Blot 1.0 ug/ml
AES-1, AES-2, Amino enhancer of split, amino-terminal enhancer of split, ESP1, Gp130-associated protein GAM, GRG, GRG5, Protein ESP1, Protein GRG, TLE5
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse GRG (Groucho homolog) (NP_034477). Peptide sequence QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK
100 μg
Apoptosis, Signal Transduction, Wnt Signaling Pathway
166
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
Primary
Mouse
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers