missing translation for 'onlineSavingsMsg'
Learn More

GPR160 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09485-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331255

  • 449.23 EUR / 100µL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

GPR160 Polyclonal specifically detects GPR160 in Human samples. It is validated for Western Blot.
Specifications

Specifications

GPR160
Polyclonal
Western Blot 1.0 ug/ml
G protein-coupled receptor 160, GPCR150GPCR1, G-protein coupled receptor GPCR1, hGPCR1, probable G-protein coupled receptor 160, putative G protein-coupled receptor
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR160 (NP_055188). Peptide sequence FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM
100 μg
GPCR
26996
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers