missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR160 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09485-100UL
Additional Details : Weight : 0.00970kg
Description
GPR160 Polyclonal specifically detects GPR160 in Human samples. It is validated for Western Blot.Specifications
GPR160 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
G protein-coupled receptor 160, GPCR150GPCR1, G-protein coupled receptor GPCR1, hGPCR1, probable G-protein coupled receptor 160, putative G protein-coupled receptor | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR160 (NP_055188). Peptide sequence FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM | |
100 μg | |
GPCR | |
26996 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |