missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dematin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17829-25UL
Additional Details : Weight : 0.00970kg
Description
Dematin Polyclonal antibody specifically detects Dematin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Dematin | |
Polyclonal | |
Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
dematin, DMTFLJ78462, Erythrocyte membrane protein band 4.9, erythrocyte membrane protein band 4.9 (dematin), FLJ98848 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT | |
25 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
2039 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |