missing translation for 'onlineSavingsMsg'
Learn More

Dematin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17829-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331316

  • 360.68 EUR / 25µL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Dematin Polyclonal antibody specifically detects Dematin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

Dematin
Polyclonal
Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
dematin, DMTFLJ78462, Erythrocyte membrane protein band 4.9, erythrocyte membrane protein band 4.9 (dematin), FLJ98848
This antibody was developed against Recombinant Protein corresponding to amino acids: DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT
25 μg
Primary
Human
Purified
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
2039
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers