missing translation for 'onlineSavingsMsg'
Learn More

Dematin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-17829-25UL

Additional Details : Weight : 0.00970kg

Product Code. 18331316

Estimated Shipment: 26-08-2024
to see stock.

Description

Dematin Polyclonal antibody specifically detects Dematin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	Dematin
Classification	Polyclonal
Dilution	Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Gene Alias	dematin, DMTFLJ78462, Erythrocyte membrane protein band 4.9, erythrocyte membrane protein band 4.9 (dematin), FLJ98848
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	2039
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description