missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17653-100UL
This item is not returnable.
View return policy
Description
DDT Polyclonal antibody specifically detects DDT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
DDT | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
D-dopachrome decarboxylase, D-dopachrome tautomeraseDDCT, EC 4.1.1.84, Phenylpyruvate tautomerase II | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDN | |
100 μg | |
Stem Cell Markers | |
1652 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction