missing translation for 'onlineSavingsMsg'
Learn More

DDT Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17653-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331314

Estimated Shipment: 26-08-2024
to see stock.

Description

DDT Polyclonal antibody specifically detects DDT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	DDT
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	D-dopachrome decarboxylase, D-dopachrome tautomeraseDDCT, EC 4.1.1.84, Phenylpyruvate tautomerase II
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDN
Quantity	100 μg
Research Discipline	Stem Cell Markers
Gene ID (Entrez)	1652
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Description