missing translation for 'onlineSavingsMsg'
Learn More

DDT Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17653-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331314

  • 575.58 EUR / 100µL
Estimated Shipment: 12-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

DDT Polyclonal antibody specifically detects DDT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

DDT
Polyclonal
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
D-dopachrome decarboxylase, D-dopachrome tautomeraseDDCT, EC 4.1.1.84, Phenylpyruvate tautomerase II
This antibody was developed against Recombinant Protein corresponding to amino acids: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDN
100 μg
Stem Cell Markers
1652
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers