missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ C8orf74 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP1-91039PEP

Additional Details : Weight : 0.00970kg

Product Code. 18331240

  • 242.97 EUR / 0.10mL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C8ORF74. The C8orf74 Recombinant Protein Antigen is derived from E. coli. The C8orf74 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-91039. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Specifications

203076
Chromatography
0.5mg/mL
PBS and 1M Urea, pH 7.4.
C8ORF74
26kDa
0.1mL
E.Coli
CQAVHTQMELLQELLQRQIQNTFAILDLKLQKKTLNLNAPTPIPPPITSHAGQEEALKPQRASKGKKAKARK
Human
>80%
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Unlabeled
C8orf74
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91039. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

For Research Use Only