missing translation for 'onlineSavingsMsg'
Learn More

BMP-8b Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10677-100UL

Product Code. 18331504

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

BMP-8b Polyclonal specifically detects BMP-8b in Human samples. It is validated for Western Blot.

Specifications

Antigen	BMP-8b
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	BMP-8, bone morphogenetic protein 8b, MGC131757
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human BMP-8b (NP_001711.2). Peptide sequence VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG
Quantity	100 μg
Research Discipline	Cytokine Research
Gene ID (Entrez)	656
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description