missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BMP-8b Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10677-100UL
Additional Details : Weight : 0.00970kg
Description
BMP-8b Polyclonal specifically detects BMP-8b in Human samples. It is validated for Western Blot.Specifications
| BMP-8b | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| BMP-8, bone morphogenetic protein 8b, MGC131757 | |
| The immunogen is a synthetic peptide directed towards the middle region of human BMP-8b (NP_001711.2). Peptide sequence VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG | |
| 100 μg | |
| Cytokine Research | |
| 656 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |